SCOP 1.65: Domain d1ow3a_: 1ow3 A:

Lineage for d1ow3a_ (1ow3 A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families)

5. Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (4 proteins)

6. Protein p50 RhoGAP domain [48352] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries)

8. Domain d1ow3a_: 1ow3 A: [87485]
   Other proteins in same PDB: d1ow3b_
   complexed with gdp, mg, mgf

Details for d1ow3a_

PDB Entry: 1ow3, 1.8 Å

PDB Description: crystal structure of rhoa.gdp.mgf3-in complex with rhogap

SCOP Domain Sequences for d1ow3a_:

Sequence; same for both SEQRES and ATOM records:

>d1ow3a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens)}
plpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqq
kynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlq
vlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainp
intftkflldhqgelf

Timeline for d1ow3a_:

• d1ow3a_ is new in SCOP 1.65
  
• d1ow3a_ appears in SCOP 1.67
  
• d1ow3a_ appears in the current release, SCOPe 2.08