SCOPe 2.08: Domain d1ovza2: 1ovz A:101-195

Lineage for d1ovza2 (1ovz A:101-195)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Ig alpha Fc receptor, FCARI (CD89) [89188] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [89189] (3 PDB entries)

8. Domain d1ovza2: 1ovz A:101-195 [87474]
   Other proteins in same PDB: d1ovza3
   complexed with nag, trs

Details for d1ovza2

PDB Entry: 1ovz, 3 Å

PDB Description: crystal structure of human fcari

PDB Compounds: (A:) Immunoglobulin alpha Fc receptor

SCOPe Domain Sequences for d1ovza2:

Sequence; same for both SEQRES and ATOM records:

>d1ovza2 b.1.1.4 (A:101-195) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]}
lygkpflsadrglvlmpgenisltcssahipfdrfslakegelslpqhqsgehpanfslg
pvdlnvsgiyrcygwynrspylwsfpsnalelvvt

Timeline for d1ovza2:

• d1ovza2 first appeared in SCOP 1.65
  
• d1ovza2 appears in SCOPe 2.07