Lineage for d1ovma1 (1ovm A:181-341)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483121Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 483122Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 483145Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 483197Protein Indole-3-pyruvate decarboxylase [89637] (1 species)
  7. 483198Species Enterobacter cloacae [TaxId:550] [89638] (1 PDB entry)
  8. 483199Domain d1ovma1: 1ovm A:181-341 [87461]
    Other proteins in same PDB: d1ovma2, d1ovma3, d1ovmb2, d1ovmb3, d1ovmc2, d1ovmc3, d1ovmd2, d1ovmd3

Details for d1ovma1

PDB Entry: 1ovm (more details), 2.65 Å

PDB Description: Crystal structure of Indolepyruvate decarboxylase from Enterobacter cloacae

SCOP Domain Sequences for d1ovma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae}
nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
paqtievqphaarvgdvwftgipmnqaietlvelckqhvha

SCOP Domain Coordinates for d1ovma1:

Click to download the PDB-style file with coordinates for d1ovma1.
(The format of our PDB-style files is described here.)

Timeline for d1ovma1: