| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily) multihelical; can be divided into three subdomains (neck, body and tail) |
Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) ![]() the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like |
| Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins) the 'neck' domain corresponds to the C-terminal part of Pfam PF01743 |
| Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species) |
| Species Human (Homo sapiens), mitochondrial [TaxId:9606] [89128] (1 PDB entry) |
| Domain d1ou5b1: 1ou5 B:151-354 [87447] Other proteins in same PDB: d1ou5a2, d1ou5a3, d1ou5b2, d1ou5b3 the tail subdomain is not present in this structure |
PDB Entry: 1ou5 (more details), 3.4 Å
SCOPe Domain Sequences for d1ou5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ou5b1 a.173.1.1 (B:151-354) tRNA CCA-adding enzyme, C-terminal domains {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
kvrfvghakqriqedylrilryfrfygrivdkpgdhdpetleaiaenakglagisgeriw
velkkilvgnhvnhlihliydldvapyiglpanasleefdkvsknvdgfspkpvtllasl
fkvqddvtkldlrlkiakeeknlglfivknrkdlikatdssdplkpyqdfiidsrepdat
trvcellkyqgehcllkemqqwsi
Timeline for d1ou5b1: