Lineage for d1ou5b1 (1ou5 B:151-354)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348878Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
    multihelical; can be divided into three subdomains (neck, body and tail)
  4. 2348879Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) (S)
    the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like
  5. 2348880Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
    the 'neck' domain corresponds to the C-terminal part of Pfam PF01743
  6. 2348885Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)
  7. 2348893Species Human (Homo sapiens), mitochondrial [TaxId:9606] [89128] (1 PDB entry)
  8. 2348895Domain d1ou5b1: 1ou5 B:151-354 [87447]
    Other proteins in same PDB: d1ou5a2, d1ou5a3, d1ou5b2, d1ou5b3
    the tail subdomain is not present in this structure

Details for d1ou5b1

PDB Entry: 1ou5 (more details), 3.4 Å

PDB Description: crystal structure of human cca-adding enzyme
PDB Compounds: (B:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1ou5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ou5b1 a.173.1.1 (B:151-354) tRNA CCA-adding enzyme, C-terminal domains {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
kvrfvghakqriqedylrilryfrfygrivdkpgdhdpetleaiaenakglagisgeriw
velkkilvgnhvnhlihliydldvapyiglpanasleefdkvsknvdgfspkpvtllasl
fkvqddvtkldlrlkiakeeknlglfivknrkdlikatdssdplkpyqdfiidsrepdat
trvcellkyqgehcllkemqqwsi

SCOPe Domain Coordinates for d1ou5b1:

Click to download the PDB-style file with coordinates for d1ou5b1.
(The format of our PDB-style files is described here.)

Timeline for d1ou5b1: