SCOP 1.65: Domain d1ou5b1: 1ou5 B:151-354

Lineage for d1ou5b1 (1ou5 B:151-354)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.173: tRNA CCA-adding enzyme, C-terminal domains [81890] (1 superfamily)
   multihelical; can be divided into three subdomains (neck, body and tail)

4. Superfamily a.173.1: tRNA CCA-adding enzyme, C-terminal domains [81891] (1 family)
   the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like

5. Family a.173.1.1: tRNA CCA-adding enzyme, C-terminal domains [81892] (1 protein)

6. Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)

7. Species Human (Homo sapiens), mitochondrial [TaxId:9606] [89128] (1 PDB entry)

8. Domain d1ou5b1: 1ou5 B:151-354 [87447]
   Other proteins in same PDB: d1ou5a2, d1ou5b2
   the tail subdomain is not present in this structure

Details for d1ou5b1

PDB Entry: 1ou5, 3.4 Å

PDB Description: crystal structure of human cca-adding enzyme

SCOP Domain Sequences for d1ou5b1:

Sequence; same for both SEQRES and ATOM records:

>d1ou5b1 a.173.1.1 (B:151-354) tRNA CCA-adding enzyme, C-terminal domains {Human (Homo sapiens), mitochondrial}
kvrfvghakqriqedylrilryfrfygrivdkpgdhdpetleaiaenakglagisgeriw
velkkilvgnhvnhlihliydldvapyiglpanasleefdkvsknvdgfspkpvtllasl
fkvqddvtkldlrlkiakeeknlglfivknrkdlikatdssdplkpyqdfiidsrepdat
trvcellkyqgehcllkemqqwsi

Timeline for d1ou5b1:

• d1ou5b1 is new in SCOP 1.65
  
• d1ou5b1 appears in SCOP 1.67
  
• d1ou5b1 appears in the current release, SCOPe 2.08