Lineage for d1ou5a2 (1ou5 A:1-150)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2613089Family d.218.1.4: Poly A polymerase head domain-like [82661] (2 proteins)
    overlaps with the N-terminal part of Pfam PF01743; this family is distinct from eukaryotic PAPs
    insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543
  6. 2613094Protein tRNA CCA-adding enzyme, head domain [82662] (2 species)
  7. 2613102Species Human (Homo sapiens), mitochondrial [TaxId:9606] [89924] (1 PDB entry)
  8. 2613103Domain d1ou5a2: 1ou5 A:1-150 [87446]
    Other proteins in same PDB: d1ou5a1, d1ou5a3, d1ou5b1, d1ou5b3

Details for d1ou5a2

PDB Entry: 1ou5 (more details), 3.4 Å

PDB Description: crystal structure of human cca-adding enzyme
PDB Compounds: (A:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1ou5a2:

Sequence, based on SEQRES records: (download)

>d1ou5a2 d.218.1.4 (A:1-150) tRNA CCA-adding enzyme, head domain {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
mklqspefqslfteglksltelfvkenhelriaggavrdllngvkpqdidfattatptqm
kemfqsagirminnrgekhgtitarlheenfeittlridvttdgrhaevefttdwqkdae
rrdltinsmflgfdgtlfdyfngyedlknk

Sequence, based on observed residues (ATOM records): (download)

>d1ou5a2 d.218.1.4 (A:1-150) tRNA CCA-adding enzyme, head domain {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
mklqspefqslfteglksltelfvkenhelriaggavrdllngvkpqdidfattatptqm
kemfqsagirminnrgekhgtitarlheenfeittlrifttdwqkdaerrdltinsmflg
fdgtlfdyfngyedlknk

SCOPe Domain Coordinates for d1ou5a2:

Click to download the PDB-style file with coordinates for d1ou5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ou5a2: