Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
Domain d1otuf2: 1otu F:107-211 [87444] Other proteins in same PDB: d1otua_, d1otub_, d1otuc1, d1otuc2, d1otud1, d1otue1, d1otue2, d1otuf1 part of anti-CLC chloride channel Fab complexed with cl; mutant |
PDB Entry: 1otu (more details), 3.3 Å
SCOP Domain Sequences for d1otuf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otuf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnra
Timeline for d1otuf2: