SCOP 1.73: Domain d1otue2: 1otu E:122-222

Lineage for d1otue2 (1otu E:122-222)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1otue2: 1otu E:122-222 [87442]
   Other proteins in same PDB: d1otua_, d1otub_, d1otuc1, d1otud1, d1otud2, d1otue1, d1otuf1, d1otuf2
   part of anti-CLC chloride channel Fab
   complexed with cl; mutant

Details for d1otue2

PDB Entry: 1otu, 3.3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148q mutant and fab complex

PDB Compounds: (E:) Fab Fragment (Heavy Chain)

SCOP Domain Sequences for d1otue2:

Sequence; same for both SEQRES and ATOM records:

>d1otue2 b.1.1.2 (E:122-222) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra

Timeline for d1otue2:

• d1otue2 first appeared in SCOP 1.65
  
• d1otue2 appears in SCOP 1.71
  
• d1otue2 appears in SCOP 1.75
  
• d1otue2 appears in the current release, SCOPe 2.08