Lineage for d1otua_ (1otu A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629845Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2629846Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2629847Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2629848Protein Clc chloride channel [69913] (2 species)
  7. 2629849Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 2629888Domain d1otua_: 1otu A: [87435]
    Other proteins in same PDB: d1otuc1, d1otuc2, d1otud1, d1otud2, d1otue1, d1otue2, d1otuf1, d1otuf2
    complexed with cl; mutant

Details for d1otua_

PDB Entry: 1otu (more details), 3.3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148q mutant and fab complex
PDB Compounds: (A:) Voltage-gated ClC-type chloride channel eriC

SCOPe Domain Sequences for d1otua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otua_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

SCOPe Domain Coordinates for d1otua_:

Click to download the PDB-style file with coordinates for d1otua_.
(The format of our PDB-style files is described here.)

Timeline for d1otua_: