Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.20: Clc chloride channel [81341] (1 superfamily) core: 18 transmembrane helices |
Superfamily f.20.1: Clc chloride channel [81340] (1 family) |
Family f.20.1.1: Clc chloride channel [69912] (2 proteins) duplication: consist of two similar structural parts |
Protein Clc chloride channel [69913] (2 species) |
Species Escherichia coli [TaxId:562] [69914] (18 PDB entries) |
Domain d1otua_: 1otu A: [87435] Other proteins in same PDB: d1otuc1, d1otuc2, d1otud1, d1otud2, d1otue1, d1otue2, d1otuf1, d1otuf2 complexed with cl; mutant |
PDB Entry: 1otu (more details), 3.3 Å
SCOPe Domain Sequences for d1otua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otua_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla qftggkplysailartlakqeaeq
Timeline for d1otua_: