SCOP 1.67: Domain d1ottf2: 1ott F:107-211

Lineage for d1ottf2 (1ott F:107-211)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1ottf2: 1ott F:107-211 [87434]
   Other proteins in same PDB: d1otta_, d1ottb_, d1ottc1, d1ottc2, d1ottd1, d1otte1, d1otte2, d1ottf1
   part of anti-CLC chloride channel Fab
   complexed with cl; mutant

Details for d1ottf2

PDB Entry: 1ott, 3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148a mutant and fab complex

SCOP Domain Sequences for d1ottf2:

Sequence; same for both SEQRES and ATOM records:

>d1ottf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

Timeline for d1ottf2:

• d1ottf2 first appeared in SCOP 1.65
  
• d1ottf2 appears in SCOP 1.69
  
• d1ottf2 appears in the current release, SCOPe 2.08