Lineage for d1ottf1 (1ott F:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354190Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (42 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2354247Domain d1ottf1: 1ott F:1-106 [87433]
    Other proteins in same PDB: d1otta_, d1ottb_, d1ottc1, d1ottc2, d1ottd2, d1otte1, d1otte2, d1ottf2
    part of anti-CLC chloride channel Fab
    complexed with cl; mutant

Details for d1ottf1

PDB Entry: 1ott (more details), 3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148a mutant and fab complex
PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d1ottf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ottf1 b.1.1.1 (F:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d1ottf1:

Click to download the PDB-style file with coordinates for d1ottf1.
(The format of our PDB-style files is described here.)

Timeline for d1ottf1: