SCOP 1.71: Domain d1ottf1: 1ott F:1-106

Lineage for d1ottf1 (1ott F:1-106)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (19 PDB entries)

8. Domain d1ottf1: 1ott F:1-106 [87433]
   Other proteins in same PDB: d1otta_, d1ottb_, d1ottc1, d1ottc2, d1ottd2, d1otte1, d1otte2, d1ottf2
   part of anti-CLC chloride channel Fab
   complexed with cl; mutant

Details for d1ottf1

PDB Entry: 1ott, 3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148a mutant and fab complex

SCOP Domain Sequences for d1ottf1:

Sequence; same for both SEQRES and ATOM records:

>d1ottf1 b.1.1.1 (F:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d1ottf1:

• d1ottf1 first appeared in SCOP 1.65
  
• d1ottf1 appears in SCOP 1.69
  
• d1ottf1 appears in SCOP 1.73
  
• d1ottf1 appears in the current release, SCOPe 2.08