![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
![]() | Domain d1otte2: 1ott E:122-222 [87432] Other proteins in same PDB: d1otta_, d1ottb_, d1ottc1, d1ottd1, d1ottd2, d1otte1, d1ottf1, d1ottf2 part of anti-CLC chloride channel Fab complexed with cl; mutant |
PDB Entry: 1ott (more details), 3 Å
SCOP Domain Sequences for d1otte2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otte2 b.1.1.2 (E:122-222) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
Timeline for d1otte2: