Lineage for d1ottb_ (1ott B:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620115Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 620116Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 620117Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 620118Protein Clc chloride channel [69913] (2 species)
  7. 620119Species Escherichia coli [TaxId:562] [69914] (4 PDB entries)
  8. 620123Domain d1ottb_: 1ott B: [87426]
    Other proteins in same PDB: d1ottc1, d1ottc2, d1ottd1, d1ottd2, d1otte1, d1otte2, d1ottf1, d1ottf2
    complexed with cl; mutant

Details for d1ottb_

PDB Entry: 1ott (more details), 3 Å

PDB Description: structure of the escherichia coli clc chloride channel e148a mutant and fab complex

SCOP Domain Sequences for d1ottb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ottb_ f.20.1.1 (B:) Clc chloride channel {Escherichia coli}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOP Domain Coordinates for d1ottb_:

Click to download the PDB-style file with coordinates for d1ottb_.
(The format of our PDB-style files is described here.)

Timeline for d1ottb_: