![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d1otsf2: 1ots F:107-211 [87424] Other proteins in same PDB: d1otsa_, d1otsb_, d1otsc1, d1otsc2, d1otsd1, d1otse1, d1otse2, d1otsf1 part of anti-CLC chloride channel Fab complexed with cl |
PDB Entry: 1ots (more details), 2.51 Å
SCOP Domain Sequences for d1otsf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otsf2 b.1.1.2 (F:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnra
Timeline for d1otsf2: