SCOPe 2.08: Domain d1otsf1: 1ots F:1-106

Lineage for d1otsf1 (1ots F:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d1otsf1: 1ots F:1-106 [87423]
   Other proteins in same PDB: d1otsa_, d1otsb_, d1otsc1, d1otsc2, d1otsd2, d1otse1, d1otse2, d1otsf2
   part of anti-CLC chloride channel Fab
   complexed with cl

Details for d1otsf1

PDB Entry: 1ots, 2.51 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel and Fab Complex

PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d1otsf1:

Sequence; same for both SEQRES and ATOM records:

>d1otsf1 b.1.1.1 (F:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d1otsf1:

• d1otsf1 first appeared in SCOP 1.65
  
• d1otsf1 appears in SCOPe 2.07