SCOPe 2.02: Domain d1otse1: 1ots E:2-121

Lineage for d1otse1 (1ots E:2-121)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (53 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1otse1: 1ots E:2-121 [87421]
   Other proteins in same PDB: d1otsa_, d1otsb_, d1otsc2, d1otsd1, d1otsd2, d1otse2, d1otsf1, d1otsf2
   part of anti-CLC chloride channel Fab
   complexed with cl

Details for d1otse1

PDB Entry: 1ots, 2.51 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel and Fab Complex

PDB Compounds: (E:) Fab Fragment (Heavy Chain)

SCOPe Domain Sequences for d1otse1:

Sequence; same for both SEQRES and ATOM records:

>d1otse1 b.1.1.1 (E:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss

Timeline for d1otse1:

• d1otse1 first appeared in SCOP 1.65
  
• d1otse1 appears in SCOPe 2.01
  
• d1otse1 appears in SCOPe 2.03
  
• d1otse1 appears in the current release, SCOPe 2.08