Lineage for d1otsd1 (1ots D:1-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511917Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 1511939Domain d1otsd1: 1ots D:1-106 [87419]
    Other proteins in same PDB: d1otsa_, d1otsb_, d1otsc1, d1otsc2, d1otsd2, d1otse1, d1otse2, d1otsf2
    part of anti-CLC chloride channel Fab
    complexed with cl

Details for d1otsd1

PDB Entry: 1ots (more details), 2.51 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel and Fab Complex
PDB Compounds: (D:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d1otsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otsd1 b.1.1.1 (D:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d1otsd1:

Click to download the PDB-style file with coordinates for d1otsd1.
(The format of our PDB-style files is described here.)

Timeline for d1otsd1: