SCOP 1.73: Domain d1otsc2: 1ots C:122-222

Lineage for d1otsc2 (1ots C:122-222)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1otsc2: 1ots C:122-222 [87418]
   Other proteins in same PDB: d1otsa_, d1otsb_, d1otsc1, d1otsd1, d1otsd2, d1otse1, d1otsf1, d1otsf2

Details for d1otsc2

PDB Entry: 1ots, 2.51 Å

PDB Description: Structure of the Escherichia coli ClC Chloride channel and Fab Complex

PDB Compounds: (C:) Fab Fragment (Heavy Chain)

SCOP Domain Sequences for d1otsc2:

Sequence; same for both SEQRES and ATOM records:

>d1otsc2 b.1.1.2 (C:122-222) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra

Timeline for d1otsc2:

• d1otsc2 first appeared in SCOP 1.65
  
• d1otsc2 appears in SCOP 1.71
  
• d1otsc2 appears in SCOP 1.75
  
• d1otsc2 appears in the current release, SCOPe 2.07