Lineage for d1otrb_ (1otr B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325382Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 325383Family d.15.1.1: Ubiquitin-related [54237] (8 proteins)
  6. 325407Protein Ubiquitin [54238] (3 species)
  7. 325408Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (1 PDB entry)
  8. 325409Domain d1otrb_: 1otr B: [87414]
    Other proteins in same PDB: d1otra_

Details for d1otrb_

PDB Entry: 1otr (more details)

PDB Description: Solution Structure of a CUE-Ubiquitin Complex

SCOP Domain Sequences for d1otrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otrb_ d.15.1.1 (B:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOP Domain Coordinates for d1otrb_:

Click to download the PDB-style file with coordinates for d1otrb_.
(The format of our PDB-style files is described here.)

Timeline for d1otrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1otra_