SCOP 1.71: Domain d1ot5a2: 1ot5 A:123-460

Lineage for d1ot5a2 (1ot5 A:123-460)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (2 families)

5. Family c.41.1.1: Subtilases [52744] (13 proteins)

6. Protein Kexin, N-terminal domain [89692] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89693] (2 PDB entries)

8. Domain d1ot5a2: 1ot5 A:123-460 [87410]
   Other proteins in same PDB: d1ot5a1, d1ot5b1

Details for d1ot5a2

PDB Entry: 1ot5, 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of kex2 in complex with a peptidyl- boronic acid inhibitor

SCOP Domain Sequences for d1ot5a2:

Sequence; same for both SEQRES and ATOM records:

>d1ot5a2 c.41.1.1 (A:123-460) Kexin, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
pvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldyen
edlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynakisg
irilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvtegrd
skgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavtyss
gsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavgle
knadgdwrdsamgkkyshrygfgkidahkliemsktwe

Timeline for d1ot5a2:

• d1ot5a2 first appeared in SCOP 1.65
  
• d1ot5a2 appears in SCOP 1.69
  
• d1ot5a2 appears in SCOP 1.73
  
• d1ot5a2 appears in the current release, SCOPe 2.08