Lineage for d1ot4a_ (1ot4 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 659214Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
  6. 659215Protein Copper resistance protein C (CopC, PcoC) [81970] (2 species)
  7. 659221Species Pseudomonas syringae [TaxId:317] [81971] (5 PDB entries)
  8. 659228Domain d1ot4a_: 1ot4 A: [87408]
    complexed with cu

Details for d1ot4a_

PDB Entry: 1ot4 (more details)

PDB Description: solution structure of cu(ii)-copc from pseudomonas syringae
PDB Compounds: (A:) copper resistance protein c

SCOP Domain Sequences for d1ot4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ot4a_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk

SCOP Domain Coordinates for d1ot4a_:

Click to download the PDB-style file with coordinates for d1ot4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ot4a_: