SCOP 1.65: Domain d1ot2a3: 1ot2 A:407-495

Lineage for d1ot2a3 (1ot2 A:407-495)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (31 PDB entries)

8. Domain d1ot2a3: 1ot2 A:407-495 [87398]
   Other proteins in same PDB: d1ot2a1, d1ot2a2, d1ot2a4
   complexed with acy, ca, epe, glc, mal, mpd; mutant

Details for d1ot2a3

PDB Entry: 1ot2, 2.1 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant d135n

SCOP Domain Sequences for d1ot2a3:

Sequence; same for both SEQRES and ATOM records:

>d1ot2a3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

Timeline for d1ot2a3:

• d1ot2a3 is new in SCOP 1.65
  
• d1ot2a3 appears in SCOP 1.67
  
• d1ot2a3 appears in the current release, SCOPe 2.08