Lineage for d1orwc2 (1orw C:509-766)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901312Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2901319Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2901455Species Pig (Sus scrofa) [TaxId:9823] [89771] (8 PDB entries)
  8. 2901486Domain d1orwc2: 1orw C:509-766 [87367]
    Other proteins in same PDB: d1orwa1, d1orwb1, d1orwc1, d1orwd1
    complexed with nag, p2y, phi, so4

Details for d1orwc2

PDB Entry: 1orw (more details), 2.84 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a peptidomimetic inhibitor
PDB Compounds: (C:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1orwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orwc2 c.69.1.24 (C:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

SCOPe Domain Coordinates for d1orwc2:

Click to download the PDB-style file with coordinates for d1orwc2.
(The format of our PDB-style files is described here.)

Timeline for d1orwc2: