Lineage for d1orsc_ (1ors C:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340499Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 340500Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 340501Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)
  6. 340506Protein Potassium channel KVAP [90107] (1 species)
  7. 340507Species Archaeon Aeropyrum pernix [TaxId:56636] [90108] (2 PDB entries)
  8. 340508Domain d1orsc_: 1ors C: [87353]
    Other proteins in same PDB: d1orsa1, d1orsa2, d1orsb1, d1orsb2
    perimeter subdomain only

Details for d1orsc_

PDB Entry: 1ors (more details), 1.9 Å

PDB Description: x-ray structure of the kvap potassium channel voltage sensor in complex with an fab

SCOP Domain Sequences for d1orsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix}
dvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayk
sgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskfls
aiadaadklvpr

SCOP Domain Coordinates for d1orsc_:

Click to download the PDB-style file with coordinates for d1orsc_.
(The format of our PDB-style files is described here.)

Timeline for d1orsc_: