Lineage for d1orqc_ (1orq C:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456013Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1456014Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1456015Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1456030Protein Potassium channel KVAP [90107] (1 species)
  7. 1456031Species Aeropyrum pernix [TaxId:56636] [90108] (3 PDB entries)
  8. 1456033Domain d1orqc_: 1orq C: [87348]
    Other proteins in same PDB: d1orqa1, d1orqa2, d1orqb1, d1orqb2
    gate and perimeter subdomains
    complexed with cd, k

Details for d1orqc_

PDB Entry: 1orq (more details), 3.2 Å

PDB Description: x-ray structure of a voltage-dependent potassium channel in complex with an fab
PDB Compounds: (C:) potassium channel

SCOPe Domain Sequences for d1orqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orqc_ f.14.1.1 (C:) Potassium channel KVAP {Aeropyrum pernix [TaxId: 56636]}
igdvmehplvelgvsyaallsvivvvvectmqlsgeylvrlylvdlilviilwadyayra
yksgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskf
lsaiadaadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattv
gygdvvpatpigkvigiavmltgisaltlligtvsnmfqkilv

SCOPe Domain Coordinates for d1orqc_:

Click to download the PDB-style file with coordinates for d1orqc_.
(The format of our PDB-style files is described here.)

Timeline for d1orqc_: