SCOP 1.69: Domain d1orqa2: 1orq A:109-215

Lineage for d1orqa2 (1orq A:109-215)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)

8. Domain d1orqa2: 1orq A:109-215 [87345]
   Other proteins in same PDB: d1orqa1, d1orqb1, d1orqb2, d1orqc_
   part of anti-VD potassium channel KVAP Fab 6E1

Details for d1orqa2

PDB Entry: 1orq, 3.2 Å

PDB Description: x-ray structure of a voltage-dependent potassium channel in complex with an fab

SCOP Domain Sequences for d1orqa2:

Sequence; same for both SEQRES and ATOM records:

>d1orqa2 b.1.1.2 (A:109-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1orqa2:

• d1orqa2 first appeared in SCOP 1.65
  
• d1orqa2 appears in SCOP 1.67
  
• d1orqa2 appears in SCOP 1.71
  
• d1orqa2 appears in the current release, SCOPe 2.08