Lineage for d1oqxd_ (1oqx D:)

  1. Root: SCOPe 2.03
  2. 1472417Class k: Designed proteins [58788] (44 folds)
  3. 1472674Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)
  4. 1472675Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) (S)
  5. 1472676Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)
  6. 1472677Protein Protein A Ig(Fc)-binding domain mimics [58866] (1 species)
  7. 1472678Species Synthetic [58867] (7 PDB entries)
  8. 1472683Domain d1oqxd_: 1oqx D: [87330]
    Other proteins in same PDB: d1oqxa1, d1oqxa2, d1oqxb1, d1oqxb2
    minimized version of protein A called mini-Z (Z34c)

Details for d1oqxd_

PDB Entry: 1oqx (more details), 2.6 Å

PDB Description: g-2 glycovariant of human igg fc bound to minimized version of protein a called z34c
PDB Compounds: (D:) Protein A Z34C

SCOPe Domain Sequences for d1oqxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqxd_ k.13.1.1 (D:) Protein A Ig(Fc)-binding domain mimics {Synthetic}
fnmqcqrrfyealhdpnlneeqrnakiksirddc

SCOPe Domain Coordinates for d1oqxd_:

Click to download the PDB-style file with coordinates for d1oqxd_.
(The format of our PDB-style files is described here.)

Timeline for d1oqxd_: