Lineage for d1oqxc_ (1oqx C:)

  1. Root: SCOP 1.73
  2. 757717Class k: Designed proteins [58788] (44 folds)
  3. 757966Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)
  4. 757967Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) (S)
  5. 757968Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)
  6. 757969Protein Protein A Ig(Fc)-binding domain mimics [58866] (1 species)
  7. 757970Species Synthetic [58867] (7 PDB entries)
  8. 757974Domain d1oqxc_: 1oqx C: [87329]
    Other proteins in same PDB: d1oqxa1, d1oqxa2, d1oqxb1, d1oqxb2

Details for d1oqxc_

PDB Entry: 1oqx (more details), 2.6 Å

PDB Description: G-2 glycovariant of human IgG Fc bound to minimized version of Protein A called Z34C
PDB Compounds: (C:) Protein A Z34C

SCOP Domain Sequences for d1oqxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqxc_ k.13.1.1 (C:) Protein A Ig(Fc)-binding domain mimics {Synthetic}
fnmqcqrrfyealhdpnlneeqrnakiksirddc

SCOP Domain Coordinates for d1oqxc_:

Click to download the PDB-style file with coordinates for d1oqxc_.
(The format of our PDB-style files is described here.)

Timeline for d1oqxc_: