![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries) |
![]() | Domain d1oqxb1: 1oqx B:236-341 [87327] Other proteins in same PDB: d1oqxa2, d1oqxb2, d1oqxc_, d1oqxd_ part of a Fc complexed with fuc, man, nag |
PDB Entry: 1oqx (more details), 2.6 Å
SCOP Domain Sequences for d1oqxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqxb1 b.1.1.2 (B:236-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)} ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg
Timeline for d1oqxb1:
![]() Domains from other chains: (mouse over for more information) d1oqxa1, d1oqxa2, d1oqxc_, d1oqxd_ |