Lineage for d1oqxa2 (1oqx A:342-445)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516151Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 1516154Species Human (Homo sapiens) [TaxId:9606] [88590] (35 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1516182Domain d1oqxa2: 1oqx A:342-445 [87326]
    Other proteins in same PDB: d1oqxa1, d1oqxb1, d1oqxc_, d1oqxd_
    part of a Fc

Details for d1oqxa2

PDB Entry: 1oqx (more details), 2.6 Å

PDB Description: g-2 glycovariant of human igg fc bound to minimized version of protein a called z34c
PDB Compounds: (A:) immunoglobulin gamma-1 heavy chain constant region

SCOPe Domain Sequences for d1oqxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqxa2 b.1.1.2 (A:342-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

SCOPe Domain Coordinates for d1oqxa2:

Click to download the PDB-style file with coordinates for d1oqxa2.
(The format of our PDB-style files is described here.)

Timeline for d1oqxa2: