| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88590] (28 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
| Domain d1oqxa2: 1oqx A:342-445 [87326] Other proteins in same PDB: d1oqxa1, d1oqxb1, d1oqxc_, d1oqxd_ part of a Fc |
PDB Entry: 1oqx (more details), 2.6 Å
SCOPe Domain Sequences for d1oqxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqxa2 b.1.1.2 (A:342-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
Timeline for d1oqxa2:
View in 3DDomains from other chains: (mouse over for more information) d1oqxb1, d1oqxb2, d1oqxc_, d1oqxd_ |