![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries) |
![]() | Domain d1oqxa2: 1oqx A:342-445 [87326] Other proteins in same PDB: d1oqxa1, d1oqxb1, d1oqxc_, d1oqxd_ |
PDB Entry: 1oqx (more details), 2.6 Å
SCOP Domain Sequences for d1oqxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqxa2 b.1.1.2 (A:342-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp
Timeline for d1oqxa2:
![]() Domains from other chains: (mouse over for more information) d1oqxb1, d1oqxb2, d1oqxc_, d1oqxd_ |