Lineage for d1oqwa_ (1oqw A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327229Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 327230Superfamily d.24.1: Pili subunits [54523] (2 families) (S)
    bacterial filament proteins
  5. 327231Family d.24.1.1: Pilin [54524] (1 protein)
  6. 327232Protein Pilin [54525] (3 species)
  7. 327238Species Pseudomonas aeruginosa, type IV pilin, pak pilin [54527] (2 PDB entries)
  8. 327240Domain d1oqwa_: 1oqw A: [87323]

Details for d1oqwa_

PDB Entry: 1oqw (more details), 2 Å

PDB Description: Full-Length PAK Pilin from Pseudomonas aeruginosa

SCOP Domain Sequences for d1oqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqwa_ d.24.1.1 (A:) Pilin {Pseudomonas aeruginosa, type IV pilin, pak pilin}
ftlielmivvaiigilaaiaipqyqnyvarsegasalasvnplkttveealsrgwsvksg
tgtedatkkevplgvaadanklgtialkpdpadgtaditltftmggagpknkgkiitltr
taadglwkctsdqdeqfipkgcsr

SCOP Domain Coordinates for d1oqwa_:

Click to download the PDB-style file with coordinates for d1oqwa_.
(The format of our PDB-style files is described here.)

Timeline for d1oqwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oqwb_