Lineage for d1oqod_ (1oqo D:)

  1. Root: SCOP 1.65
  2. 348801Class k: Designed proteins [58788] (39 folds)
  3. 348997Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)
  4. 348998Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) (S)
  5. 348999Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)
  6. 349000Protein Protein A Ig(Fc)-binding domain mimics [58866] (1 species)
  7. 349001Species Synthetic [58867] (7 PDB entries)
  8. 349004Domain d1oqod_: 1oqo D: [87318]
    Other proteins in same PDB: d1oqoa1, d1oqoa2, d1oqob1, d1oqob2
    minimized version of protein A called mini-Z (Z34c)
    complexed with fuc, man, nag

Details for d1oqod_

PDB Entry: 1oqo (more details), 2.3 Å

PDB Description: complex between g0 version of an fc bound to a minimized version of protein a called mini-z

SCOP Domain Sequences for d1oqod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqod_ k.13.1.1 (D:) Protein A Ig(Fc)-binding domain mimics {Synthetic}
fnmqcqrrfyealhdpnlneeqrnakiksirddc

SCOP Domain Coordinates for d1oqod_:

Click to download the PDB-style file with coordinates for d1oqod_.
(The format of our PDB-style files is described here.)

Timeline for d1oqod_: