Lineage for d1oqoc_ (1oqo C:)

  1. Root: SCOPe 2.03
  2. 1472417Class k: Designed proteins [58788] (44 folds)
  3. 1472674Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)
  4. 1472675Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) (S)
  5. 1472676Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)
  6. 1472677Protein Protein A Ig(Fc)-binding domain mimics [58866] (1 species)
  7. 1472678Species Synthetic [58867] (7 PDB entries)
  8. 1472680Domain d1oqoc_: 1oqo C: [87317]
    Other proteins in same PDB: d1oqoa1, d1oqoa2, d1oqob1, d1oqob2
    minimized version of protein A called mini-Z (Z34c)

Details for d1oqoc_

PDB Entry: 1oqo (more details), 2.3 Å

PDB Description: complex between g0 version of an fc bound to a minimized version of protein a called mini-z
PDB Compounds: (C:) Minimized version of Protein A (Z34C)

SCOPe Domain Sequences for d1oqoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqoc_ k.13.1.1 (C:) Protein A Ig(Fc)-binding domain mimics {Synthetic}
fnmqcqrrfyealhdpnlneeqrnakiksirddc

SCOPe Domain Coordinates for d1oqoc_:

Click to download the PDB-style file with coordinates for d1oqoc_.
(The format of our PDB-style files is described here.)

Timeline for d1oqoc_: