Lineage for d1oqob2 (1oqo B:342-443)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289555Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 289558Species Human (Homo sapiens) [TaxId:9606] [88590] (19 PDB entries)
  8. 289565Domain d1oqob2: 1oqo B:342-443 [87316]
    Other proteins in same PDB: d1oqoa1, d1oqob1, d1oqoc_, d1oqod_
    part of a Fc
    complexed with fuc, man, nag

Details for d1oqob2

PDB Entry: 1oqo (more details), 2.3 Å

PDB Description: complex between g0 version of an fc bound to a minimized version of protein a called mini-z

SCOP Domain Sequences for d1oqob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqob2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1oqob2:

Click to download the PDB-style file with coordinates for d1oqob2.
(The format of our PDB-style files is described here.)

Timeline for d1oqob2: