Lineage for d1oqoa2 (1oqo A:342-444)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655861Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 655864Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries)
  8. 655870Domain d1oqoa2: 1oqo A:342-444 [87314]
    Other proteins in same PDB: d1oqoa1, d1oqob1, d1oqoc_, d1oqod_

Details for d1oqoa2

PDB Entry: 1oqo (more details), 2.3 Å

PDB Description: Complex between G0 version of an Fc bound to a minimized version of Protein A called Mini-Z
PDB Compounds: (A:) immunoglobulin gamma-1 heavy chain constant region

SCOP Domain Sequences for d1oqoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqoa2 b.1.1.2 (A:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOP Domain Coordinates for d1oqoa2:

Click to download the PDB-style file with coordinates for d1oqoa2.
(The format of our PDB-style files is described here.)

Timeline for d1oqoa2: