SCOP 1.71: Domain d1oqoa2: 1oqo A:342-444

Lineage for d1oqoa2 (1oqo A:342-444)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries)

8. Domain d1oqoa2: 1oqo A:342-444 [87314]
   Other proteins in same PDB: d1oqoa1, d1oqob1, d1oqoc_, d1oqod_

Details for d1oqoa2

PDB Entry: 1oqo, 2.3 Å

PDB Description: complex between g0 version of an fc bound to a minimized version of protein a called mini-z

SCOP Domain Sequences for d1oqoa2:

Sequence; same for both SEQRES and ATOM records:

>d1oqoa2 b.1.1.2 (A:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d1oqoa2:

• d1oqoa2 first appeared in SCOP 1.65
  
• d1oqoa2 appears in SCOP 1.69
  
• d1oqoa2 appears in SCOP 1.73
  
• d1oqoa2 appears in the current release, SCOPe 2.08