Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries) |
Domain d1oqoa2: 1oqo A:342-444 [87314] Other proteins in same PDB: d1oqoa1, d1oqob1, d1oqoc_, d1oqod_ |
PDB Entry: 1oqo (more details), 2.3 Å
SCOP Domain Sequences for d1oqoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqoa2 b.1.1.2 (A:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)} qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls
Timeline for d1oqoa2:
View in 3D Domains from other chains: (mouse over for more information) d1oqob1, d1oqob2, d1oqoc_, d1oqod_ |