SCOP 1.75: Domain d1oqoa1: 1oqo A:237-341

Lineage for d1oqoa1 (1oqo A:237-341)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries)
   Uniprot P01857 #118-327
   Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d1oqoa1: 1oqo A:237-341 [87313]
   Other proteins in same PDB: d1oqoa2, d1oqob2, d1oqoc_, d1oqod_
   part of a Fc

Details for d1oqoa1

PDB Entry: 1oqo, 2.3 Å

PDB Description: complex between g0 version of an fc bound to a minimized version of protein a called mini-z

PDB Compounds: (A:) immunoglobulin gamma-1 heavy chain constant region

SCOP Domain Sequences for d1oqoa1:

Sequence; same for both SEQRES and ATOM records:

>d1oqoa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d1oqoa1:

• d1oqoa1 first appeared in SCOP 1.65
  
• d1oqoa1 appears in SCOP 1.73
  
• d1oqoa1 appears in SCOPe 2.01
  
• d1oqoa1 appears in the current release, SCOPe 2.07