Lineage for d1oqbf_ (1oqb F:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1485832Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1485833Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species)
  7. 1485834Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries)
  8. 1485853Domain d1oqbf_: 1oqb F: [87263]
    complexed with fe2

Details for d1oqbf_

PDB Entry: 1oqb (more details), 2.8 Å

PDB Description: the crystal structure of the one-iron form of the di-iron center in stearoyl acyl carrier protein desaturase from ricinus communis (castor bean).
PDB Compounds: (F:) Acyl-[acyl-carrier protein] desaturase

SCOPe Domain Sequences for d1oqbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqbf_ a.25.1.2 (F:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]}
fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d1oqbf_:

Click to download the PDB-style file with coordinates for d1oqbf_.
(The format of our PDB-style files is described here.)

Timeline for d1oqbf_: