SCOP 1.73: Domain d1oq7e_: 1oq7 E:

Lineage for d1oq7e_ (1oq7 E:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species)

7. Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries)

8. Domain d1oq7e_: 1oq7 E: [87255]

Details for d1oq7e_

PDB Entry: 1oq7, 3.2 Å

PDB Description: The crystal structure of the iron free (Apo-)form of Stearoyl Acyl Carrier Protein Desaturase from Ricinus Communis (Castor Bean).

PDB Compounds: (E:) Acyl-[acyl-carrier protein] desaturase

SCOP Domain Sequences for d1oq7e_:

Sequence; same for both SEQRES and ATOM records:

>d1oq7e_ a.25.1.2 (E:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]}
fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd
eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr
awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer
atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad
mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls
aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

Timeline for d1oq7e_:

• d1oq7e_ first appeared in SCOP 1.65
  
• d1oq7e_ appears in SCOP 1.71
  
• d1oq7e_ appears in SCOP 1.75
  
• d1oq7e_ appears in the current release, SCOPe 2.08