![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species) |
![]() | Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries) |
![]() | Domain d1oq4a_: 1oq4 A: [87245] complexed with azi, fe |
PDB Entry: 1oq4 (more details), 2.4 Å
SCOPe Domain Sequences for d1oq4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oq4a_ a.25.1.2 (A:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]} fmpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfd eqvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtr awtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqer atfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafad mmrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltgls aegqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
Timeline for d1oq4a_: