SCOP 1.67: Domain d1oplb2: 1opl B:252-518

Lineage for d1oplb2 (1opl B:252-518)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (6 PDB entries)

8. Domain d1oplb2: 1opl B:252-518 [87239]
   Other proteins in same PDB: d1opla1, d1opla2, d1oplb1
   complexed with myr, p16; mutant

Details for d1oplb2

PDB Entry: 1opl, 3.42 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

SCOP Domain Sequences for d1oplb2:

Sequence; same for both SEQRES and ATOM records:

>d1oplb2 d.144.1.7 (B:252-518) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)}
dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
ylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
racwqwnpsdrpsfaeihqafetmfqe

Timeline for d1oplb2:

• d1oplb2 first appeared in SCOP 1.65
  
• d1oplb2 appears in SCOP 1.69
  
• d1oplb2 appears in the current release, SCOPe 2.08