Lineage for d1oplb1 (1opl B:140-237)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1424633Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1424634Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1424635Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1424636Protein Abl tyrosine kinase [55581] (2 species)
  7. 1424637Species Human (Homo sapiens) [TaxId:9606] [55582] (2 PDB entries)
  8. 1424640Domain d1oplb1: 1opl B:140-237 [87238]
    Other proteins in same PDB: d1opla1, d1opla3, d1oplb2
    complexed with myr, p16

Details for d1oplb1

PDB Entry: 1opl (more details), 3.42 Å

PDB Description: Structural basis for the auto-inhibition of c-Abl tyrosine kinase
PDB Compounds: (B:) proto-oncogene tyrosine-protein kinase

SCOPe Domain Sequences for d1oplb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oplb1 d.93.1.1 (B:140-237) Abl tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypap

SCOPe Domain Coordinates for d1oplb1:

Click to download the PDB-style file with coordinates for d1oplb1.
(The format of our PDB-style files is described here.)

Timeline for d1oplb1: