SCOP 1.65: Domain d1opla1: 1opl A:81-139

Lineage for d1opla1 (1opl A:81-139)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.34: SH3-like barrel [50036] (13 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (26 proteins)

6. Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50053] (4 PDB entries)

8. Domain d1opla1: 1opl A:81-139 [87235]
   Other proteins in same PDB: d1opla2, d1opla3, d1oplb1, d1oplb2
   complexed with myr, p16; mutant

Details for d1opla1

PDB Entry: 1opl, 3.42 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

SCOP Domain Sequences for d1opla1:

Sequence; same for both SEQRES and ATOM records:

>d1opla1 b.34.2.1 (A:81-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus)}
dpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

Timeline for d1opla1:

• d1opla1 is new in SCOP 1.65
  
• d1opla1 appears in SCOP 1.67
  
• d1opla1 appears in the current release, SCOPe 2.08