Lineage for d1opka3 (1opk A:241-531)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334933Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 334934Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 334971Family d.144.1.7: Protein kinases, catalytic subunit [88854] (41 proteins)
    members organised in the groups and subfamiles specified by the comments
  6. 334975Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 334976Species Mouse (Mus musculus) [TaxId:10090] [56167] (6 PDB entries)
  8. 334979Domain d1opka3: 1opk A:241-531 [87234]
    Other proteins in same PDB: d1opka1, d1opka2
    complexed with gol, myr, p16; mutant

Details for d1opka3

PDB Entry: 1opk (more details), 1.8 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

SCOP Domain Sequences for d1opka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opka3 d.144.1.7 (A:241-531) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)}
kptiygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeve
eflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvll
ymatqissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakf
pikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerp
egcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk

SCOP Domain Coordinates for d1opka3:

Click to download the PDB-style file with coordinates for d1opka3.
(The format of our PDB-style files is described here.)

Timeline for d1opka3: