Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Abl tyrosine kinase [55581] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [89998] (2 PDB entries) |
Domain d1opka2: 1opk A:140-240 [87233] Other proteins in same PDB: d1opka1, d1opka3 complexed with gol, myr, p16 |
PDB Entry: 1opk (more details), 1.8 Å
SCOPe Domain Sequences for d1opka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas dgklyvssesrfntlaelvhhhstvadglittlhypapkrn
Timeline for d1opka2: