Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1op5k2: 1op5 K:108-213 [87219] Other proteins in same PDB: d1op5h1, d1op5h2, d1op5k1, d1op5l1, d1op5m1, d1op5m2 |
PDB Entry: 1op5 (more details), 3 Å
SCOP Domain Sequences for d1op5k2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1op5k2 b.1.1.2 (K:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d1op5k2: