SCOP 1.73: Domain d1op5h1: 1op5 H:1-115

Lineage for d1op5h1 (1op5 H:1-115)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (66 PDB entries)

8. Domain d1op5h1: 1op5 H:1-115 [87216]
   Other proteins in same PDB: d1op5h2, d1op5k1, d1op5k2, d1op5l1, d1op5l2, d1op5m2

Details for d1op5h1

PDB Entry: 1op5, 3 Å

PDB Description: crystal structure of fab 2g12 bound to man9glcnac2

PDB Compounds: (H:) FAB 2G12, heavy chain

SCOP Domain Sequences for d1op5h1:

Sequence; same for both SEQRES and ATOM records:

>d1op5h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
vspas

Timeline for d1op5h1:

• d1op5h1 first appeared in SCOP 1.65
  
• d1op5h1 appears in SCOP 1.71
  
• d1op5h1 appears in SCOP 1.75
  
• d1op5h1 last appears in SCOPe 2.07